SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q115S3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q115S3
Domain Number 1 Region: 105-219
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000262
Family Collagen-binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 254-336
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000114
Family Collagen-binding domain 0.0044
Further Details:      
 
Domain Number 3 Region: 363-453
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000209
Family Collagen-binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q115S3
Sequence length 715
Comment (tr|Q115S3|Q115S3_TRIEI) Peptidase-like {ECO:0000313|EMBL:ABG50751.1} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_1461 OC=Microcoleaceae; Trichodesmium.
Sequence
MDIEREINSFFSDLFGTKADSKSDLFSLSNHKINYFDSTSDITIKNSTLEDNINSTEYSL
GSYNFLGNELESISIRDSASVENTEEIDKITGDNFDTNIQLRAGQKSDNKIDTATEIDIV
SGEKVKINDRIGYKEKGKVDKYDYYSFGISENMEVSIDMDKLQKNANLHLFDESGKKVLA
KSNKRGKKSENITEYLDAGDYYLRVSAVGNAKTPYRLILEKVPDDKNIDGANDLGKLSQK
ELKLNDKIGYKKKGKVDKYDYYSFGISEDMKVNIEMDKLQKNANLHLFDESGKKVLAKSN
KRGKKSENITEYLDAGDYYLRVSAVGNAKTPYRLILENVPDDKSIDGANNLGKLSQKELK
VNDKIGYRENGKRDGIDLYFFEINEEQEVDINLNKLKQNSNLRLIDEDGETVLDKSTNKG
KNSEKITEVLEPGIYYVEVYAQGNAKTNYELSLSSQEVNTVFPSVLETYESGTRVGFENR
VSLEIPEGWVGKQKSMFETIFEGRSFVDGQYFPFTLTSTKYPDVYVELSVRSNYLTGLIQ
NLANTWAIDETTYEPQGKAKVKGNQITNTYTAKNSISQEKYYVVSTVGPNDEIATVTVGG
SVNKLKDYKDIANDVVESLDFPEPTDWEEFFSDHWLAYAPYGSIYEGIFLDDDRSFYHIY
DYSTNRFGTWDITQKDELVLRYENGEEKVGQLDGPSVSNNIIYGEFVYQAIEKNS
Download sequence
Identical sequences Q115S3
gi|113475163|ref|YP_721224.1| 203124.Tery_1461 WP_011611128.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]