SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q116B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q116B6
Domain Number 1 Region: 4-248
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.85e-50
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q116B6
Sequence length 248
Comment (tr|Q116B6|Q116B6_TRIEI) Thioesterase {ECO:0000313|EMBL:ABG50658.1} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_1343 OC=Microcoleaceae; Trichodesmium.
Sequence
MNTIATPSPWIKIFQPCPQPQLRLFCFHPSAAGATLFRLWGKYLPSNIEVCAIQLPGRET
RIKETLITKWDDLLSPLIQELQPLITEYPFVFFGHSLGALISFEVVRQLRRQKLPIPKYM
FVSGRRPPHIPIDNLRHQAPNPILISILREYGGTPEAVLQNQDLMELFLPILRADFTLNE
KYIYFPEAPFEFPIVAFRGTDDIEVSKQKLSQWEQHTISNFALHEFPGGHMFFQQQPKVL
IEAILKFI
Download sequence
Identical sequences Q116B6
203124.Tery_1343 gi|113475070|ref|YP_721131.1| WP_011611037.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]