SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q11AD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q11AD2
Domain Number 1 Region: 7-45
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000196
Family Rho termination factor, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q11AD2
Sequence length 731
Comment (tr|Q11AD2|Q11AD2_TRIEI) Rho termination factor-like {ECO:0000313|EMBL:ABG49542.1} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_0018 OC=Microcoleaceae; Trichodesmium.
Sequence
MVQERPPLEEMTLRQLRKVASELGISRYSRMRKAQLLAAVIEAQGMNNLSSAPLSKLEVQ
ERAEAKKFESGEENNIDDFFSSVDEGLTDLPNGYAKSKIVLMPRDPEWAYAYWDISNELK
EELRSQGGQQLALRTYDVTDINLDSQSPHSIQEYPCDELAREWYIPIPVSDRNYTVEIGY
RCADGRWLVLSRSEEVNIPPVYPSDWIDEQFITVSWDEDLRGKTFMELFPASRQITFHDN
HDDIYQGMFGIAEAEDKRVSGSMFGSVQMVPGSGQMIEETLSSYAMVSGLGMWASGSNVS
CGNQMMSGVGQTMSGVGLNASGVGLTASGVGLTASGVGLTASGVGLNASGVGLTASGVGL
NASGVGLTASGVGLNASGVGLTASGVGLNASGVGLTASGVGLNASGVGLTASGVGLNASG
VGLTASGVGLNASGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGVGMNMSGVGLT
ASGMGMNMSGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGM
GMNMSGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGMGMNM
SGVGLTASGMGMNMSGVGLTASGMGMNMSGIAGSIPPIRPRKFWLVADAELIIHGATEPD
ATVTIGGRPIKLNPDGTFRFQMAFPDGLIDYPIMAVAVDGEQNRSIHMQFTRETPERHTN
KKEEAILEWMS
Download sequence
Identical sequences Q11AD2
203124.Tery_0018 gi|113473954|ref|YP_720015.1| WP_011609946.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]