SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q11W14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q11W14
Domain Number 1 Region: 314-472
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.93e-28
Family HD domain 0.036
Further Details:      
 
Domain Number 2 Region: 210-299
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q11W14
Sequence length 522
Comment (sp|Q11W14|RNY_CYTH3) Ribonuclease Y {ECO:0000255|HAMAP-Rule:MF_00335} KW=Complete proteome; Reference proteome OX=269798 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469). GN=CHU_1127; OC=Cytophaga.
Sequence
MSELIMYILATAVVSIGVGIVAGKAIFQKDFSKQETEAKEKANLIIKEAELKAEATKKDK
QLEAKEHFLKLKTEFEEDSNKKKNLIIQNEQKIKQREQTISKQMETNTRREAELDSLREN
LSSQLEILNKRKEELEKLRHSQIEKLEKIAGLTGEEAKAQLMDTIKEEARTEASSYIKRI
TDEAKMTATKDAKKIVIETLQRTATENAVENCVSIFNIESDDIKGKIIGREGRNIRALEA
ATGVEIIVDDTPEAIIISGFDPVRREVARLSLHRLVQDGRIHPARIEEVVTKTAKHLDEE
IIEIGERTAIDLGIHGLHPELIRLVGRMRFRSSYGQNLLQHSREVAKLCATMASELGLNA
KVAKRAGLLHDIGKVYPDEPELPHAILGMELAKKYKESAEICNAIGAHHDEIEMTGLISP
IVQVCDAISGARPGARREVMEQYIKRLKDLEQLALSFDGVLKCYAIQAGRELRIMVDAEN
VSDDKAGILSFDIAQKIEKEMQYPGQIKVTVIREMRAVNFAK
Download sequence
Identical sequences Q11W14
ChR80 WP_011584517.1.19587 WP_011584517.1.79486 269798.CHU_1127 gi|110637535|ref|YP_677742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]