SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q12129 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q12129
Domain Number - Region: 4-69,133-159
Classification Level Classification E-value
Superfamily PIN domain-like 0.00785
Family PIN domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q12129
Sequence length 218
Comment (sp|Q12129|NMD4_YEAST) Nonsense-mediated decay protein 4 KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=NMD4; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MTQYNFIIDASAFEKGLGNIKRWCSDCTEAVTLNFYIPTFTLNELDFLQQRRKSFAARES
LKFIDRLDDSKFANLKVFIEFPEVLDIILWSDVMEHNDSSGKINIAKLPKRLKNLLKSCI
YKCYLEGNEGLHWFLISEDPQIREMAMQCNIPSCSIVDVDSILSKDMNDKSFRESEKFNN
MMLKNGTKEESENGREIIRTNFNKTVYASRGTGELWSP
Download sequence
Identical sequences E7NL05 G2WJI1 N1NZP9 Q12129
YLR363C NP_013467.3.97178 YLR363C YLR363C YLR363C YLR363C YLR363C YLR363C 4932.YLR363C YLR363C YLR363C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]