SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q12350 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q12350
Domain Number 1 Region: 58-170
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.000000000000157
Family Chaperone J-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q12350
Sequence length 301
Comment (sp|Q12350|JID1_YEAST) J domain-containing protein 1 KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=JID1; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MLHHKFVYPFLFKWHLSCVEKCPPQITFIAKYATANDKNGNRKLTIRDEQWPELADPTPY
DIFGIPKAGSGNPKLDKKSLKKKYHRYVKLYHPDHSDNIQIFSSEKVTNSDSKSPLLLTS
SEKLHRFKVISQAYDILCDPKKKIVYDTTRQGWTTSYSPRSNVNTENYQYAGSYGYHSNA
QYEYWNAGTWEDANSMKNERIQENINPWTVIGIICGLAICIEGTALLAKIQESLSKAEFT
HDESGLHLIQSYTNYGLDTDKFSRLRRFLWFRTWGLYKSKEDLDREAKINEEMIRKLKAA
K
Download sequence
Identical sequences A0A0L8VG22 B3LLB5 C7GY47 N1NVK2 Q12350
YPR061C YPR061C APC90050 YPR061C YPR061C YPR061C SCRT_02546 NP_015386.1.97178 YPR061C YPR061C YPR061C 4932.YPR061C YPR061C YPR061C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]