SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q12R95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q12R95
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.19e-42
Family SMI1/KNR4-like 0.00000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q12R95
Sequence length 133
Comment (tr|Q12R95|Q12R95_SHEDO) Uncharacterized protein {ECO:0000313|EMBL:ABE54031.1} KW=Complete proteome; Reference proteome OX=318161 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013). GN=Sden_0741 OC=Shewanellaceae; Shewanella.
Sequence
MHELIEQLQALNEPVPVPLELASFEQLVEVEEQILISLPRELKVYLMEASDVVYGHIEPV
TASDPQSHTYLPEVTCYAWSIGLPRELIAICQQGDNFYCIDQDGQVHFWKNGRFVGEVFE
SFWHWVDRVWLNN
Download sequence
Identical sequences Q12R95
WP_011495196.1.19895 gi|91792103|ref|YP_561754.1| 318161.Sden_0741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]