SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q12U22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q12U22
Domain Number 1 Region: 435-544
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.3e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q12U22
Sequence length 550
Comment (tr|Q12U22|Q12U22_METBU) Sulphate transporter {ECO:0000313|EMBL:ABE53054.1} KW=Complete proteome; Reference proteome OX=259564 OS=ACE-M). GN=Mbur_2189 OC=Methanosarcinaceae; Methanococcoides.
Sequence
MRTEQKVKNYFEESFLSDLKAGLITAVVALPLAIAFAIASGVEPVMGLYTAIIAGMLVST
FGGSRYSISGPTGAMTVIVLSTVNGYGVEGLLLAGVLAGVFQILFGIFRLGKVVKYIPLP
VISGFTSGIGIIILIGQLSNVFGLVLPAREHVWETVYDVFTSIDAMNILALSMFAGTIIL
MLLLPKVLSNIKYLKNIPASIITLVLSVILTYHFDLKIPIVGEIPSIIPQIHMLDINIGL
MYAVLPAAFTIALLGTIESLLCAVVCDAMTNTKHNSNKELIGQGIANVILPFFAGIPATA
AIARSAVNIREGAKTRMSGVIHALVLLGILIFFGPIAQYIPKAYLAGILVLVSIKMVNVD
EIRTTINISKMDTFVLLTTFALTVLTDLVFAIQAGMFLSIILLFIRLTNIIDVQSMEGYD
PSEGINATILSDPYLKDNVAVYTINGPFFFGAMAVFENKVDEHIHMSKPHIIIRMRYVPF
IDTTGIERLKSFITTRKGTGEKVYLTTVQPEVMRSINSDTVLSKLMQEKDVIVFKSTQEA
LGYLQEREGN
Download sequence
Identical sequences Q12U22
WP_011500190.1.71292 gi|91774112|ref|YP_566804.1| 259564.Mbur_2189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]