SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q12U67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q12U67
Domain Number 1 Region: 51-228
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.66e-24
Family Terpene synthases 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q12U67
Sequence length 234
Comment (tr|Q12U67|Q12U67_METBU) Uncharacterized protein {ECO:0000313|EMBL:ABE53009.1} KW=Complete proteome; Reference proteome OX=259564 OS=ACE-M). GN=Mbur_2139 OC=Methanosarcinaceae; Methanococcoides.
Sequence
MEEMIKNTFGWIREQEITTAKGLSRLITAYELWGVENDFPTKLIQLKSENNWDNSIRETA
RACSSLASSNFDLEKCGEWLLSKRENNGSWGNDVYDTTYALIALAEMEIHETKGCKWLVE
NYGEKWEHVGTTSLIITTLAKQEALTKDKHFTDFIEERARWILSERAEEGGWKFISTSNL
VIQALVIVGLKEELKQSLNWLISRQNNNGSWGKNEGDITATALSLITLGYAHRQ
Download sequence
Identical sequences Q12U67
259564.Mbur_2139 WP_011500147.1.71292 gi|91774067|ref|YP_566759.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]