SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q13562 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q13562
Domain Number 1 Region: 101-159
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q13562
Sequence length 356
Comment (sp|Q13562|NDF1_HUMAN) Class A basic helix-loop-helix protein 3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NEUROD1; OC=Catarrhini; Hominidae; Homo.
Sequence
MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLETMNAEEDSLRNGGEEE
DEDEDLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAA
LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPT
TNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVF
HVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT
MHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHD
Download sequence
Identical sequences A0A0S2Z493 Q13562
ENSP00000295108 9606.ENSP00000295108 ENSP00000295108 ENSP00000295108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]