SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q13797 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q13797
Domain Number 1 Region: 30-461
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.66e-83
Family Integrin alpha N-terminal domain 0.00000109
Further Details:      
 
Domain Number 2 Region: 461-620
Classification Level Classification E-value
Superfamily Integrin domains 1.73e-30
Family Integrin domains 0.0017
Further Details:      
 
Domain Number 3 Region: 624-762
Classification Level Classification E-value
Superfamily Integrin domains 2.56e-28
Family Integrin domains 0.004
Further Details:      
 
Domain Number 4 Region: 768-983
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000000225
Family Integrin domains 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q13797
Sequence length 1035
Comment (sp|Q13797|ITA9_HUMAN) Integrin alpha-RLC KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ITGA9; OC=Catarrhini; Hominidae; Homo.
Sequence
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNT
RWVLVGAPKADSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDR
DDEWMGVSLARQPKADGRVLACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCY
EEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTIKVLNLTDNTYLKLNDEVIM
NRRYTYLGYAVTAGHFSHPSTIDVVGGAPQDKGIGKVYIFRADRRSGTLIKIFQASGKKM
GSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
NAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLSGQKIN
PVLRMFGQSISGGIDMDGNGYPDVTVGAFMSDSVVLLRARPVITVDVSIFLPGSINITAP
QCHDGQQPVNCLNVTTCFSFHGKHVPGEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMG
QVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVL
RWKKGQKIAQKNQTVFERNCRSEDCAADLQLQGKLLLSSMDEKTLYLALGAVKNISLNIS
ISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKYE
FSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVDTSITGIMSPT
SFVYGESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEM
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLT
AHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPE
EVTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKN
RKENEDSWDWVQKNQ
Download sequence
Identical sequences Q13797
9606.ENSP00000264741 ENSP00000264741 ENSP00000264741 ENSP00000397258 NP_002198.2.87134 NP_002198.2.92137 gi|52485941|ref|NP_002198.2| NYSGRC-52485941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]