SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q14258 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q14258
Domain Number 1 Region: 450-628
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-51
Family SPRY domain 0.00083
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily RING/U-box 3.76e-19
Family RING finger domain, C3HC4 0.0097
Further Details:      
 
Domain Number 3 Region: 147-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000275
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q14258
Sequence length 630
Comment (sp|Q14258|TRI25_HUMAN) Zinc finger protein 147 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TRIM25; OC=Catarrhini; Hominidae; Homo.
Sequence
MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQAR
PQLHKNTVLCNVVEQFLQADLAREPPADVWTPPARASAPSPNAQVACDHCLKEAAVKTCL
VCMASFCQEHLQPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICL
VEHKTCSPASLSQASADLEATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQ
LQQEYTEMKALLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT
KRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQCIGRLQEPTP
SSGDPGEHDPASTHKSTRPVKKVSKEEKKSKKPPPVPALPSKLPTFGAPEQLVDLKQAGL
EAAAKATSSHPNSTSLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYTVAS
VAEMPQNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPES
RLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLM
YKFRVDFTEALYPAFWVFSAGATLSICSPK
Download sequence
Identical sequences Q14258
NP_005073.2.87134 NP_005073.2.92137 ENSP00000323889 ENSP00000445961 9606.ENSP00000323889 gi|68160937|ref|NP_005073.2| ENSP00000323889 ENSP00000445961 ENSP00000323889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]