SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q14DK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q14DK5
Domain Number 1 Region: 678-786
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 2 Region: 190-581
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 3.92e-33
Family Soluble quinoprotein glucose dehydrogenase 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q14DK5
Sequence length 791
Comment (sp|Q14DK5|HIPL1_MOUSE) HHIP-like protein 1 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Hhipl1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAGRRAVARIGPGALLVLRALLAAAHPQCLDFRPPFRPPQPLSFCAQYSAFGCCTAEQDA
ALARRFRVLETRMDAGVWATCAGYALDLLCQECSPYAAHLYDAEDPATPLRTVPGLCEDY
CLDMWQTCRGLFRLLSPDRELWALESNRAKLCRYLSLDDTDYCFPSLLVNENLNSNLGRV
VADAKGCLQLCLEEVANGLRNPVAMVHAGDGSHRFFVAEQVGLVWTYLPDRSRLEKPFLN
VSQAVLTSPWEGDERGFLGLAFHPRFPHPSKLYVYYSVGVGFREWIRISEFRVSEGDENT
VDHGSERIILEIEEPASNHNGGQLLFGDDGFLYIFTGDGGMAGDPFGKFGNAQNKSALLG
KVLRIDVDRKERGLHYGIPPDNPFVDDPGARPEVYALGVRNMWRCSFDRGDPMSGTGRGR
LFCGDVGQNKYEEVDLVERGRNYGWRAREGFECYDRKLCANTSLDDVLPIFAYPHKLGKS
VTGGYVYRGCEYPNLNGLYIFGDFMSGRLMSLRENPETGQWKYSEVCMGRGQTCAFPGLI
NNYYPYIISFAEDEAGELYFMSTGVPSATAAHGVIYKVIDPSRRAPPGKCKIRPAQVKVR
SHLIPFVPKEKFIRTPESTPRPTARAPTKAPRRRRPTAAPPAPTPRPTKPARPTRRPGAR
KGGGRRRGRPSTAVPEPENGSVRLVRPAGLSPGRGRVEVFIGGRWGTVCDDAWDTKAAAV
VCRQLGFAHAVRAAKRAEFGEGRALRILLDDVRCAGSERNLLECAHAGVGTHNCKHDEDA
GVECSHQDPNL
Download sequence
Identical sequences Q14DK5
ENSMUSP00000021685 ENSMUSP00000021685 NP_001037845.1.92730 ENSMUSP00000021685 10090.ENSMUSP00000021685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]