SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q15435 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q15435
Domain Number 1 Region: 79-354
Classification Level Classification E-value
Superfamily L domain-like 1.36e-54
Family Internalin LRR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q15435
Sequence length 360
Comment (sp|Q15435|PP1R7_HUMAN) Protein phosphatase 1 regulatory subunit 22 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PPP1R7; OC=Catarrhini; Hominidae; Homo.
Sequence
MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPE
EEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQ
SLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIE
NLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSN
RLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQE
FWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF
Download sequence
Identical sequences A0A140VK83 G3RAM0 Q15435
ENSP00000385022 ENSGGOP00000012493 gi|4506013|ref|NP_002703.1| ENSP00000234038 ENSP00000385657 ENSGGOP00000012493 9606.ENSP00000234038 NP_002703.1.87134 NP_002703.1.92137 XP_003813113.1.60992 XP_004033524.1.27298 ENSP00000234038 ENSP00000385657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]