SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q15784 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q15784
Domain Number 1 Region: 118-180
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.71e-18
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q15784
Sequence length 382
Comment (sp|Q15784|NDF2_HUMAN) NeuroD-related factor KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NEUROD2; OC=Catarrhini; Hominidae; Homo.
Sequence
MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKGDAPPPPPPAPGPGAPGPARAAKPVPL
RGEEGTEATLAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRKMTKARLERSK
LRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSG
KRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQGADGAGRFHGSGGPFAMHPYP
YPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLS
PPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLS
YDMHLHHDRGPMYEELNAFFHN
Download sequence
Identical sequences A0A2I3TJA7 G3SDZ7 Q15784
gi|98986461|ref|NP_006151.3| 9606.ENSP00000306754 ENSGGOP00000000485 ENSGGOP00000000485 ENSP00000306754 ENSP00000306754 ENSP00000306754 NP_006151.3.87134 NP_006151.3.92137 XP_004041860.1.27298 XP_009430550.2.37143 XP_511456.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]