SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q16322 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q16322
Domain Number 1 Region: 212-461
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.46e-58
Family Voltage-gated potassium channels 0.00044
Further Details:      
 
Domain Number 2 Region: 86-183
Classification Level Classification E-value
Superfamily POZ domain 8.37e-25
Family Tetramerization domain of potassium channels 0.00000711
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q16322
Sequence length 511
Comment (sp|Q16322|KCA10_HUMAN) Voltage-gated potassium channel subunit Kv1.8 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KCNA10; OC=Catarrhini; Hominidae; Homo.
Sequence
MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKILISESTNHE
TAFSKLPGDYADPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLSQFPETLLGDREKRMQ
FFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDIFADEISFYELGSEAMDQFR
EDEGFIKDPETLLPTNDIHRQFWLLFEYPESSSAARAVAVVSVLVVVISITIFCLETLPE
FREDRELKVVRDPNLNMSKTVLSQTMFTDPFFMVESTCIVWFTFELVLRFVVCPSKTDFF
RNIMNIIDIISIIPYFATLITELVQETEPSAQQNMSLAILRIIRLVRVFRIFKLSRHSKG
LQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMT
TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPGEI
ERILNSVGSRMGSTDSLNKTNGGCSTEKSRK
Download sequence
Identical sequences Q16322
ENSP00000358786 gi|5031819|ref|NP_005540.1| 9606.ENSP00000358786 NP_005540.1.87134 NP_005540.1.92137 ENSP00000358786 ENSP00000358786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]