SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q16720 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q16720
Domain Number 1 Region: 50-191,351-465,842-1060
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.75e-123
Family Calcium ATPase, transmembrane domain M 0.00081
Further Details:      
 
Domain Number 2 Region: 470-489,628-896
Classification Level Classification E-value
Superfamily HAD-like 3.62e-53
Family Meta-cation ATPase, catalytic domain P 0.00025
Further Details:      
 
Domain Number 3 Region: 477-687
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 9.59e-48
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0068
Further Details:      
 
Domain Number 4 Region: 193-291
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.14e-27
Family Calcium ATPase, transduction domain A 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q16720
Sequence length 1220
Comment (sp|Q16720|AT2B3_HUMAN) Plasma membrane calcium pump isoform 3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ATP2B3; OC=Catarrhini; Hominidae; Homo.
Sequence
MGDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEEAYGDVSGLC
RRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIV
SLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEK
QFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKID
ESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEE
KKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANAPKKEKSVL
QGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFII
GVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTT
NRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVG
NKTECALLGFVLDLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKG
ASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDFSAGQEPD
WDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCG
IIQPGEDFLCLEGKEFNRRIRNEKGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDS
TTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVM
WGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALA
TEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAP
LHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVI
VQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQLKCLKEAGHGPGKDEMTD
EELAEGEEEIDHAERELRRGQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESKTSIHN
FMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSA
TSSVFSSSPGSPLHSVETSL
Download sequence
Identical sequences A0A2I3RUL1 G3QWB4 Q16720
ENSP00000263519 ENSP00000343886 ENSP00000263519 ENSP00000343886 ENSP00000461370 ENSP00000468854 NP_001001344.1.87134 NP_001001344.1.92137 XP_003804897.1.60992 XP_004065122.1.27298 XP_005274747.1.92137 XP_016799994.1.37143 gi|48255955|ref|NP_001001344.1| 9606.ENSP00000263519 ENSP00000343886 ENSP00000460886 ENSGGOP00000007069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]