SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q16881 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q16881
Domain Number 1 Region: 160-540
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.77e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000857
Further Details:      
 
Domain Number 2 Region: 517-648
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.41e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000158
Further Details:      
 
Domain Number 3 Region: 59-150
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.13e-16
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q16881
Sequence length 649
Comment (sp|Q16881|TRXR1_HUMAN) Thioredoxin reductase TR1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TXNRD1; OC=Catarrhini; Hominidae; Homo.
Sequence
MGCAEGKAVAAAAPTELQTKGKNGDGRRRSAKDHHPGKTLPENPAGFTSTATADSRALLQ
AYIDGHSVVIFSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDL
PVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKE
AAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
EETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEK
IYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLA
GIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVV
AQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIY
AIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKA
VEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQ
GFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG
Download sequence
Identical sequences Q16881
ENSP00000434516 ENSP00000412045 NP_001087240.1.87134 NP_001087240.1.92137 gi|148277071|ref|NP_001087240.1| ENSP00000434516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]