SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q176W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q176W5
Domain Number 1 Region: 8-247
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.65e-82
Family Calponin-homology domain, CH-domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 267-388
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-32
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 3 Region: 2194-2354
Classification Level Classification E-value
Superfamily Spectrin repeat 1.75e-31
Family Spectrin repeat 0.00059
Further Details:      
 
Domain Number 4 Region: 3048-3202
Classification Level Classification E-value
Superfamily Spectrin repeat 2.46e-31
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 5 Region: 1559-1713
Classification Level Classification E-value
Superfamily Spectrin repeat 6.14e-31
Family Spectrin repeat 0.0006
Further Details:      
 
Domain Number 6 Region: 665-783
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-27
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 7 Region: 3735-3849
Classification Level Classification E-value
Superfamily PH domain-like 8.41e-27
Family Pleckstrin-homology domain (PH domain) 0.00041
Further Details:      
 
Domain Number 8 Region: 1772-1924
Classification Level Classification E-value
Superfamily Spectrin repeat 5.17e-26
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 9 Region: 2837-2967
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-26
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 10 Region: 2411-2567
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-26
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 11 Region: 3261-3380
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-25
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 12 Region: 3366-3518
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-24
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 13 Region: 2974-3080
Classification Level Classification E-value
Superfamily Spectrin repeat 2.28e-24
Family Spectrin repeat 0.0003
Further Details:      
 
Domain Number 14 Region: 1079-1192
Classification Level Classification E-value
Superfamily Spectrin repeat 3.72e-24
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 15 Region: 561-697
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-23
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 16 Region: 1351-1469
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-23
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 17 Region: 2626-2769
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-22
Family Spectrin repeat 0.00083
Further Details:      
 
Domain Number 18 Region: 945-1080
Classification Level Classification E-value
Superfamily Spectrin repeat 2.2e-22
Family Spectrin repeat 0.00074
Further Details:      
 
Domain Number 19 Region: 1982-2138
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-22
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 20 Region: 1192-1293
Classification Level Classification E-value
Superfamily Spectrin repeat 8.49e-17
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 21 Region: 334-496
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-16
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 22 Region: 834-893
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000459
Family SH3-domain 0.00099
Further Details:      
 
Domain Number 23 Region: 3526-3623
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000849
Family Spectrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q176W5
Sequence length 4155
Comment (tr|Q176W5|Q176W5_AEDAE) Beta chain spectrin {ECO:0000313|VectorBase:AAEL006242-PA} KW=Complete proteome; Reference proteome OX=7159 OS=Aedes aegypti (Yellowfever mosquito) (Culex aegypti). GN=AAEL006242 OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MTQREGIIKFENERIKTLQEERLHIQKKTFTKWMNSFLVKAKMEVDDLFTDLADGIKLLK
LLEIISGEKLGKPNNGRMRVHKIENVNKSLAFLHTKVRLESIGAEDIVDHNPRLILGLIW
TIILRFQIQEIEIDVDEENESSEKKSAKDALLLWCQRKTQGYQHVHITDFTNSWRSGLGF
NALIHSHRPDLFDYNSLMPGRNIENLNHAFEVADRELGIPRLLDAEDIDTARPDEKSILT
YVASYYHTFARMKNEQKGGKRIANIVNKLMDADKKKMQFENLITDLLSWIRNKTTELEKR
NFPNSVEGIQRELLAFKEYRTIEKPPKYKERSEIEALFFHVNTLLKSLNQPHYTPQDGKM
INDIEKAWQRLENAEHNREVALREELLRQEKLEQLNYKFEKKSVLREGYLNEMIQVLSDP
RYGANIRQVDATVKKHEAISADILARADRFNDLTDMCNELHNENYHGKERVKKRETEVIG
KWKELLELLENHKVKLTQMSGLMNLLREIDATMSTIQALKVQFASEDVGPHLLGVEELLQ
AHSLLELQVTTLGETQRRYIRQGEAFKKSGTKDTSQLDQKLAELAKSYEELQGCSAERRA
RLDEAHDFYQFVEDHENEEGWLVDKQRICKAGITAKDLRAVVSLQQKHKALEDEMKVRKP
KTLQITEAGKKLITDKHPRKADVQTKIESLQEHWKALEDLADVRKRQLDDAAEAYQFYAD
ANEADSWLNEKMALVASDDFGVDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIK
AGICTLDLSAEPEPAQELEQEEWVNETRLVPKEVWEEEPVERLEHKTVTENKLLPHVRAL
YPFEGQGMKMAKNEIMILQNKTNPDWWNVRKLDGSEGFVPANYVKEIEARPVPCLIRKAE
KVKVMQKVKKTILVKQVVPVKRVRPAKVSQVKPLVKRRTEGDTSIDSNDSVDKRQKDINS
TYDQLQELAERRRALLEDSICLFRFYRECDDFEKWIKDKEKMLRTDDPKDNVESAKRKFE
TFLTDLSASSKRVEAIDSDVEDFVRQGHSQLDKVKARQRQIHQMWEHLNYLKGQKEKNLE
GASSVELFNRTCEEAIDWMNEKMTQLDTAEVGPDLKTVQALQRRHENLERELAPVQEKVS
RVNLLGNTVKNSYPSERDNVTEKQKDIQALWRKVEEKAKERRSRLENAVGQQIFTNSSKA
LLNWIDGVHNQLNAAEPARDVETAENLWKKHNDLGEDIKAHDDEFKQLSQLGKQLMQRNP
NLVDVPETLKKLADEQEALYAAWKVKEQKLQQCIELQVFNREADKIDATTKSHEAYLEYD
DLGSSLDDVEAILKRHTDFENSLGAQDKILKNFSEGADKLIRNNHYDANYIAERRDQVLL
RRERVKDLAQKRRNALQASKDFQKFSADVDDLNVWLADKAKIAGDESYKDLTNLPRKLQK
HKAFERELRANEGQLRTVNKEGEALIKTNNRAEEVTSMLAAVNQKWKDLNQSSLEKGRRL
EQASLQREHNRNIEDAKSKLEELGAALQSKQVGSDLRSCKDLMNKHQILENDVGMWEQKV
AELVTSGEEMAHEGHFDANNIKNETKKLQNQFKHLKGPAAKRREALDESLRFHKFVFELD
AELQWINEHLPAASSEVIGQNLHQAQSLYKKHKKLEAEIEGHQPMINRTLTSAENLINQD
HPEKAKVKELCNTLELAWNDLQEKGNERSKKLELSLKAQQYLSEAGEIETWLGERNNVLR
STDYGRDRDSATKLLTKHKGIELELDTYSGIVSEMGHAASAMVSSKHPDSKVIAAKQQLI
EKMLKSLQKLAAQRQLRLMESLYRHEYFMESADLEQWIKEQEQAVNSEDYGHDYEHLLIL
KNKFDDLKHRIEVGAERFNQCEEFAKKLIGSDSPYVADIEKRQEQLSNCWQNLLKQLAAR
EKKLHAAGEIHRFHRDAAEALFRIQDKNAALSTELGKDLNSALALSRKQEAFENELVALE
AQLQFLVDDSLRLQAKYPGDNAKAIAAEQENVIQAWNILKEKSALRNDQLQASCDLQHFL
TQVRDLMSWATNLRATLQAEEHVSDATGATALKIQHDAIYGEIEAREETFRYLNELSDSM
VQTGHYAATEVEEKCSALLDERAKLHSAYNKKKILLEQKIDLFCFMRDAKVIDNLSSGQE
AALSSSDFGQTVEVVQDQIKKHDAFEKLIQTQDEKVAILQDHGRKLVEQNHYDSENIRRR
LREIVDRRQKIKELCALRRQKLQNALLYTQFIRDCAEAGTWINEKQKKLEADATSFADVS
NMEDKVKKLQKHQAFQAEVAANEGRIREVKQKGEMLIKKRHECAAEIEDEVRKLSESWNV
LLNEVASRGRGLEEAQDILEFDSQLDKLEAWIRDKEMMVHASDTGRDLEHCNALKRKLDD
VDSDMRVDDQRIKTINVLADKLLTQDKVPNEAKNVQQRRNNFNNKWKSLQGALNKYRELL
DGAYEIHVFNRDVDDTAERISEKQVAMSVDDTGRDLNAVEALKRKQDAMKRDMTAVQQKI
QEHEKRAKLLAQKYPDNAVNIEEKLAELKRQWNNLQEASVKRAEALENGYTAHKFTADVK
ELELWTNDIMKKMDSSSNPTTIAECQAQIQLHRERKAEIDGRDKIFKALQEHGERLVANN
KAMGVKNDYVEKALRQLEDLNKHLHDSWKGKDRFLKEAYQLQQFKEQADQIEAWLANKEA
FLNNDDLGDTFTAVEALIKKHEAFEKLLAASRTDELEKFAEEILAESPFEADVIKQRLCS
VIARKNKLLASSAARKQKLQESLQLQQFLRGLYEVAKWIAQKMQVALDENYREPSNLQSK
IQKHVAFDAELGANSTRVTAIIDEGETLINAEHYASELVKEQLDILEADWQKLREASREK
KECLAEAYEARLFERNLDDFNNWMDEVEGQLSSEDYGKDLASVNNLLKKHEMLEADVAHH
LETCEQIKAADDKFLVSDHFMKDELHESAMMTIKRYHSLHEPTTIRRDNLEDSLQLHQFL
RDAEDELLWLNEKEPLAASKDLGSSLTAVQSLQKKHQALEAEILSQEPTISALIQRGQQM
IRENHYAVEQIESQSNLLQQKLVNLRDLTNVRRLRLLDAVESQQFYAEANEAESWLKEKK
PIISSHDYGKDEDSVGSLQKKLDALQRELVAFKPTVEKIDKLAVGLQERGHFDSEKIKTK
NDKIQYQFHELNRLAGEREKKLAETKKLFEFIREIDDLQEWIEMQMTTAGSEEYGTDVEH
VEQLTAQFESFVSNMNSNEARVNACVAKGESLLNEGNPNKDIIKGKRDETKQLWEELKDL
VVARQEALAGAKQVHVFDRTADETIGWINEKISAVLSEDYSHDLETIQALVRTHEGFEAE
LGAIKEQLESVVAEAQKLGDTFPDAKEHIEVKRDETIEAWSELKEKTIQRKEKLMQAEQL
QAYFDEYRDLMAWINEMLAQITAPELAKDVAGAEALIVKIKEHKTEVDSRSEAFETFYKT
GNKLIKDGHLLANEVQVKIGVLEQRKRLLDNTISQRAEIYELNLDTQLFLKEAEVIESWI
ITRQVQLKDGKLGDSIAQVEDLIRKHEDFEKTVAAQEEKVLALKRITLLEQKFKKQLEAE
HAARIAEKERIERERHEALKQKEVQRITEERRRHDANSSAVNGYDTPIKSSTPSHLSPAS
AAGLSKEAPDMSPVQKSNSFATMLQERLRRGSEGNIKRAESMKIGPKPAKRTPSFTTRRR
AQSFRKNQRGLEPAESDLPPVEMQGMLERKHESQSGGKKAPVRSWKPFYTVLCGQLLCFF
KDVEDFAQKKAATAPVNILSAKCERAEDYTKKKNVFRLVLQDASEFLFLTGSKESMNEWV
NKIAFHAALPPNLQLMSYDESMKINPQSPILDRSDANSSISSRTSSPDSQRRDSRASLNS
AKSGGSGSNASSSLQTPQIAFLQKQKELREQENQQRLSQQQQQQQQNISTFQTPQSPTQE
FYGLADKPPIPPRGVPPPVPQRQSSTENVLNNNVSSNSTVQIRPKTSSGSSGSYNGNDYD
NGNYTNAPRPFSHQPNTATQRGVPVNGSNNNNGNGEDVWLRHSELRSSGWGQSRHEANRP
ASLPVGGVPPTTVSSPGDMSGLVLGRHQQQSAESSSESEASFIKGGGSTKEAKDKKAGSS
GVFRIFSKKKSKNHN
Download sequence
Identical sequences Q176W5
7159.AAEL006242-PA AAEL006242-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]