SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q17JJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q17JJ4
Domain Number 1 Region: 23-126
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 1.28e-41
Family Chemosensory protein Csp2 0.0000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q17JJ4
Sequence length 128
Comment (tr|Q17JJ4|Q17JJ4_AEDAE) AAEL001967-PA {ECO:0000313|EMBL:EAT46846.1} KW=Complete proteome; Reference proteome OX=7159 OS=Aedes aegypti (Yellowfever mosquito) (Culex aegypti). GN=AAEL001967 OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MKFFIVALVLIAVAAARPQEDKYTTKYDSIDIDEILKSDRLFKNYFNCLMDTGACTPEGN
ELKRVLPDSLENNCSKCSEKQQTSSTKIIKFLTENKPEEWTMLKAKYDPDNKYVQKYVAD
ADKDGIKL
Download sequence
Identical sequences Q17JJ4
7159.AAEL001967-PA AAEL001967-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]