SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q17JK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q17JK8
Domain Number 1 Region: 21-125
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 4.45e-43
Family Chemosensory protein Csp2 0.000064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q17JK8
Sequence length 126
Comment (tr|Q17JK8|Q17JK8_AEDAE) Protein serine/threonine kinase, putative {ECO:0000313|VectorBase:AAEL001969-PA} KW=Complete proteome; Reference proteome OX=7159 OS=Aedes aegypti (Yellowfever mosquito) (Culex aegypti). GN=AAEL001969 OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MKLFAVVALALFAVAAAQEKYTTKYDGVDLDEILKSDRLFNNYYKCLMDQGRCTPDGNEL
KRVLPDALKTDCAKCSPKQRDGTQKVVNYLIDNRPSQWKNLQAKYDPQNIYVEKYRTEAK
KAGIKL
Download sequence
Identical sequences Q17JK8
XP_001660754.1.48696 AAEL001969-PA 7159.AAEL001969-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]