SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q17N08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q17N08
Domain Number 1 Region: 123-234
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000000144
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 
Domain Number 2 Region: 40-127
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000903
Family Insect pheromone/odorant-binding proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q17N08
Sequence length 306
Comment (tr|Q17N08|Q17N08_AEDAE) AAEL000837-PA {ECO:0000313|EMBL:EAT48137.1} KW=Complete proteome; Reference proteome OX=7159 OS=Aedes aegypti (Yellowfever mosquito) (Culex aegypti). GN=AAEL000837 OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MVQFVILLITHLAQLVTAADRHKIVYKSLQEANNECSLYNVPGGCLPRCVTQITRDWNDT
VGMSPVYGRFFQPDPNDLCSNNRTERCLESKSSLISSKKTCLQASESVQCFMDHYGEINM
TAPQFVRFTKLQDVQLIFECAAMLGYSSMEQLDALLRDSEFKRQETRCVFRCVMIRSGLY
SDSEGLNMPRYYVLCGGYEDGFYQQAAECSARLRKEVPCDDKCTLAQRMANECIGVDYET
SIMQSKGNTVNTIYAIQGSEVYNIDGQNANSNVALTSVQRDKTINIENTNSDLNKFGDTI
NVDNQP
Download sequence
Identical sequences Q17N08
7159.AAEL000837-PA AAEL000837-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]