SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q17QJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q17QJ3
Domain Number 1 Region: 44-206
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.07e-47
Family Dual specificity phosphatase-like 0.0000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q17QJ3
Sequence length 211
Comment (sp|Q17QJ3|DUS26_BOVIN) Dual specificity protein phosphatase 26 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=DUSP26; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MCPGNWLWASVTFMARFSRSGSRSPVRVRGALEEPPAVQHPFLNVFELERLLYTGKTACN
HADEVWPGLYLGDQEIANNHRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHD
SPAFDMSVHFQAAADFIHRALSQPGGRILVHCAVGVSRSATLVLAYLMLYHRLTLVEAIK
KVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Download sequence
Identical sequences Q17QJ3 W5NQN9
9913.ENSBTAP00000021830 ENSOARP00000000479 ENSBTAP00000021830 NP_001069472.1.59421 NP_001069472.1.76553 XP_010818620.1.76553 XP_020765785.1.74333 ENSBTAP00000021830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]