SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q18395 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q18395
Domain Number 1 Region: 124-337
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.79e-22
Family Nuclear receptor ligand-binding domain 0.0058
Further Details:      
 
Domain Number 2 Region: 2-82
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.44e-20
Family Nuclear receptor 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q18395
Sequence length 347
Comment (tr|Q18395|Q18395_CAEEL) Nuclear Hormone Receptor family {ECO:0000313|EMBL:CCD66533.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=C33G8.10 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MLCQVCGAEGPEPHFGGISCRACAAFFRRYVHSRKLDISCTCKHRLATSHPCRHCRMLKC
MATGMVKCKVQGSREKNKITTSSLPGHISSISLLSARIVPRDCSNISCTVSKWTKVEKMR
KDLYGEKICEINFTQFSSFVKRDTHLLWDLGEKIFTDVKLLSEADKHSILCNFFPRWMML
DSAVAICPDYEESKAYIKSKDYTDMLLHFYGSSMPKEKRLKDHEILKIFKPYWDFHYYET
AVPIHFKKLDKIEYMAIFLLLLFDDAYTNISEEGVKLCQNVRKVVQRELKGYQTDSNCDE
MRFVETMDTLLLLEKAEEKIQEEVLICGFNNVTLHEDFRTIFQVKKL
Download sequence
Identical sequences Q18395
C33G8.10 6239.C33G8.10 NP_504769.1.50509 C33G8.10 C33G8.10 C33G8.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]