SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q1IXU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1IXU3
Domain Number 1 Region: 129-172
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000549
Family Type I dockerin domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q1IXU3
Sequence length 178
Comment (tr|Q1IXU3|Q1IXU3_DEIGD) Uncharacterized protein {ECO:0000313|EMBL:ABF45941.1} KW=Complete proteome; Reference proteome OX=319795 OS=Deinococcus geothermalis (strain DSM 11300). GN=Dgeo_1646 OC=Deinococcaceae; Deinococcus.
Sequence
MKALIRPLLLALSLTAGAQAATVKFRPQGAQLTQAVQAALAAISTKETPITLDTSGGPIL
TLGGSGASAVPFNPDVVARTLSVGGERRIELNPQGPLPLAEAIRTTLASELGLKEWTVAA
ARTRLSGADLNGDGVIDLADLALLMENYGKTGAVLGDLNQDRKVDDADVRLFSAQYQP
Download sequence
Identical sequences Q1IXU3
319795.Dgeo_1646 WP_011530775.1.71355 gi|94985746|ref|YP_605110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]