SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q1L981 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1L981
Domain Number 1 Region: 496-593
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.68e-19
Family Tudor domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q1L981
Sequence length 905
Comment (sp|Q1L981|TDRD5_DANRE) Tudor domain-containing protein 5 KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=tdrd5; OC=Cyprinidae; Danio.
Sequence
MTQDQLLAGLKKDVRSLLVSSKHGLTPEHLRRDYQSMLGFPMPLRLLGFRNVLDMVKEMP
EVVRLEYQLDGNIILKAIGDDTTKGIEELVSKQRDHKPKPNNRKGKPGYFNISYPRLQPV
ILPRRGQAKPALPAHLRSQLKQLLSHGPVRLSELESRYVAQFGKPLNVTQYGFFSISEML
SAAMDFIIMQQSRTGSQLLLRSAVTPQNQPENLMRRFSMQSTSPKQRLAGFSPKASSLPE
RRPEVSLDPSSVSKPEPVKEEQSFEETVFKLEEELRQQILEKGTAGTVSQELKEKLRKVV
AENGNGISIHNLPTEYQRMHGEELPVSQCGFLSVTEMVGALSDTLAIQRGTDESESHWMV
VEFKPIDTQPCEPELSPGDGTTSSPTGELQNPSSRAFYFSCPESAWEHEETEPLTDSQES
DAELRVANKTIHQMVNLFPELMVSRVSAVPLDAVRCQKLKPPVHRKERELLPVLVEQTES
PSYFYIRFSQNKEARALENMMIEMRSCYSYPDVAERYRLPDAYVRPGQVCCVAPRDMWFY
RVVIHEVFSETEVKVYYVDYGDITKVERHSLRFLKACYADLPAQAVPAMLAGVRPITNIW
PASAVSCFQRLCCERTLVAGVHSYQEDFLLLFLCDTNTEEDVYVHLALIQEGHAQPCSAA
YGLVSEKFNPVTSYFGYDQLEDVKESLSPFSCSPDAEIDSQGNDSPSSCRTASNSESGET
NLASIDVDPNLDLPPLEVINVPDVNTAAKSENVNPFEALVRKDPLFNSEWDQGWTAEDKT
DETKFELDVSTEQSKPETVYTPSPVQAAVGKQQLCASPVEPKVNATTCVNPHNPVPIQIN
CSYPVLPGVPVYPVKPPISQFMMQLLGNPVYQGPGPNTAFQHLTSPLALRPAARMSAGGQ
ILHWS
Download sequence
Identical sequences Q1L981
ENSDARP00000122775 ENSDARP00000122775 NP_001038315.1.45394 7955.ENSDARP00000096428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]