SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q1LLZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1LLZ7
Domain Number 1 Region: 18-181
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.59e-44
Family Glutathione peroxidase-like 0.0000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q1LLZ7
Sequence length 182
Comment (tr|Q1LLZ7|Q1LLZ7_CUPMC) Alkyl hydroperoxide reductase, peroxiredoxin (Thioredoxin-dependent peroxide reductase) {ECO:0000313|EMBL:ABF08829.1} KW=Complete proteome; Reference proteome OX=266264 OS=/ CH34) (Ralstonia metallidurans). GN=Rmet_1950 OC=Burkholderiaceae; Cupriavidus.
Sequence
MKTVGDKLEAFHVVGVKPGFNNHEENGQSAFEDITEKSFEGKWKVIYFYPKDFTFVCPTE
IVAFAKLNGDFADRDAIVLGGSTDNEFVKLAWRREHKDLNKLNQWQFADVTGSLVDQLGV
RDQAAGVALRATFIVDPDNTIQHVSVNNLNVGRNPEEVLRILDGLQTDELCPCNRAVGGA
TL
Download sequence
Identical sequences A0A132HN53 A0A2A4MC95 L2E9I3 Q1LLZ7
gi|94310888|ref|YP_584098.1| WP_008651557.1.12480 WP_008651557.1.22474 WP_008651557.1.25839 WP_008651557.1.38154 WP_008651557.1.481 WP_008651557.1.52493 WP_008651557.1.63697 WP_008651557.1.64716 WP_008651557.1.66126 266264.Rmet_1950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]