SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q1LPR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1LPR5
Domain Number 1 Region: 72-202
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.27e-21
Family Glutathione S-transferase (GST), C-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.05e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q1LPR5
Sequence length 213
Comment (tr|Q1LPR5|Q1LPR5_CUPMC) Glutathione S-transferase {ECO:0000313|EMBL:ABF07861.1} KW=Complete proteome; Reference proteome OX=266264 OS=/ CH34) (Ralstonia metallidurans). GN=Rmet_0975 OC=Burkholderiaceae; Cupriavidus.
Sequence
MLKLCGFAASNYYNKVKLAMLEKNQPFEEVLAWLGQTDLQASPLGKVPYIITDAGPLCES
EVIDEYIEAAYPGSPLLPKDPYQAAKVREVITFLELYLELTARELYPEAFFGGKVSDSVK
ERQRKLLERYIPGFAKLAKFSPYIAGDTFTLADCAAICHLPLISSCTKIIYGEDLLAGLP
AKDYLKAMAERPSVQKVNADRKANLEQMAARNK
Download sequence
Identical sequences Q1LPR5
266264.Rmet_0975 WP_011515779.1.12480 WP_011515779.1.25839 WP_011515779.1.52493 gi|94309920|ref|YP_583130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]