SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q1LRR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1LRR9
Domain Number 1 Region: 45-203
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.05e-50
Family Glutathione peroxidase-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q1LRR9
Sequence length 204
Comment (tr|Q1LRR9|Q1LRR9_CUPMC) Cytochrome oxidase assembly protein, Sco1/SenC family {ECO:0000313|EMBL:ABF07157.1} KW=Complete proteome; Reference proteome OX=266264 OS=/ CH34) (Ralstonia metallidurans). GN=Rmet_0271 OC=Burkholderiaceae; Cupriavidus.
Sequence
MSTSSQGLWAAFRRFWLLALCTALLAACGQPKPSFRNVDISGATEFGKDFALLDPTGKTR
TLADFKGKVVLMFFGYTHCPDVCPTTMVELKQVMEQMGPDADKVQVLFVTVDPDRDTAAL
MAQYVPAFDSRFLGLRPADEAALKKVTKDFKVYYAKVPGSSPDNYTMDHSAGSYVFDQNG
QLRLFIRHGQGPEPIAHDLKQLMS
Download sequence
Identical sequences Q1LRR9
gi|94309216|ref|YP_582426.1| WP_011515161.1.12480 WP_011515161.1.25839 WP_011515161.1.52493 266264.Rmet_0271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]