SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q1LVY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1LVY2
Domain Number 1 Region: 5-114
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.42e-36
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 2 Region: 89-213
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.12e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q1LVY2
Sequence length 475
Comment (tr|Q1LVY2|Q1LVY2_DANRE) RAB GTPase-activating protein 1-like {ECO:0000313|Ensembl:ENSDARP00000122088} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=rabgap1l OC=Cyprinidae; Danio.
Sequence
ESAQEAVITRDIHRTFPAHDYFKDSGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVL
LLHMPEEQAFCVLVKIMFNYGLRELYRNNFEDLHCKFYQLERLLQELLPDLWSHFQELNL
EAHMYASQWFLTLFTAKFPLCMVFHITDLLLCEGLNIIFNVALALLKTSKEDLLQADFEG
ALKFFRVQLPKRYRAAENARRLMEQACNIKVPTKKLKKFEKEYQSLRESQLQQEDPIDRY
QRENRRLQEASMRLEQENDDLAHELVTSKIALRNDLDQAEDKADVLNKELLNTKQRLVET
EEEKRRQEEETAQLKEVFRRELEKAEQEIKKTTAIIAEYKQICSQLSTRLEKQQASTKEE
LDIVKAKVMACERCREVFSKDGPLQIPPVSQDNRDTDLDEEKDSLKAQLRELELELAQTK
LQLVEAKCKIQELEHQRGVLMTEVQAAKNSWFSKTLGSLKNSASNQSPSSPKEGP
Download sequence
Identical sequences Q1LVY2
ENSDARP00000122088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]