SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q1M5T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1M5T3
Domain Number 1 Region: 3-182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-27
Family Beta-D-xylosidase C-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q1M5T3
Sequence length 194
Comment (tr|Q1M5T3|Q1M5T3_RHIL3) Uncharacterized protein {ECO:0000313|EMBL:CAK03406.1} KW=Complete proteome; Reference proteome OX=216596 OS=Rhizobium leguminosarum bv. viciae (strain 3841). GN=pRL110453 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MSIDFNDGKWLNEPAHWQATETGLILTTDEKTDFWRETHYGFTRDSGHFLAFPTTDSFTA
QIRVRGEFRTLYDQAGLMVRIDERRWVKTGVEFTDGEAYLSTVVTDGKSDWSVAQPFREL
EDFRIRVTVANGAMRIQASRDGSFWPLLRLAPFPAADHYEVGPTACTPERSGLTVRFCEF
SIGPAITTDLHDLS
Download sequence
Identical sequences Q1M5T3
gi|116255654|ref|YP_771487.1|NC_008384 RlR239 216596.pRL110453 WP_011655189.1.100861 WP_011655189.1.53928 gi|116255654|ref|YP_771487.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]