SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q1MG31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1MG31
Domain Number 1 Region: 8-178
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.33e-33
Family YdeN-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q1MG31
Sequence length 184
Comment (tr|Q1MG31|Q1MG31_RHIL3) Uncharacterized protein {ECO:0000313|EMBL:CAK08092.1} KW=Complete proteome; Reference proteome OX=216596 OS=Rhizobium leguminosarum bv. viciae (strain 3841). GN=RL2604 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MKASDADILIIPGYTNSGPSHWQSRWEAKLSTARRVEQAEWTKPVREDWIARIAEEVNAS
TRPVVLVAHSLGVPSVIHAIPHFRNRVAGAFLVAPPDVANPDIRPKHLMTFGPYPRDPLP
FPSITVASRNDPFGSYEHADDVAGSWGSFLVDAGEAGHINADSGHGPWPEGTMVFAQFLG
RLSA
Download sequence
Identical sequences Q1MG31
WP_011652152.1.53928 WP_011652152.1.54942 216596.RL2604 gi|116252350|ref|YP_768188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]