SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q20YY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q20YY6
Domain Number 1 Region: 78-198
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.32e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.0023
Further Details:      
 
Domain Number 2 Region: 1-74
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.5e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q20YY6
Sequence length 217
Comment (tr|Q20YY6|Q20YY6_RHOPB) Glutathione S-transferase-like {ECO:0000313|EMBL:ABD89650.1} KW=Complete proteome; Reference proteome OX=316056 OS=Rhodopseudomonas palustris (strain BisB18). GN=RPC_4124 OC=Bradyrhizobiaceae; Rhodopseudomonas.
Sequence
MYKLYSMQRSGNSYKVRLALAFLDAPYRAIEVDILSGESRTPDFLAKNPSGQVPLLEVAE
GRYLAESNAILWYLGVGTSLAPESRIDRADALQWMFFEQHALEPNIGAAYFWLSLVKGGR
DLQTHALEDWMERGYAALQVMENHLKDNDYFAAGQLTIADIALYGYTHVADQCDFDLEAF
PAIGAWLKRVQQSPGYVSMNWRPESISDDAPGIAAEA
Download sequence
Identical sequences Q20YY6
gi|90425599|ref|YP_533969.1| 316056.RPC_4124 WP_011474531.1.69038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]