SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q210I6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q210I6
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.41e-63
Family Glutathione peroxidase-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q210I6
Sequence length 158
Comment (tr|Q210I6|Q210I6_RHOPB) Glutathione peroxidase {ECO:0000256|RuleBase:RU000499} KW=Complete proteome; Reference proteome OX=316056 OS=Rhodopseudomonas palustris (strain BisB18). GN=RPC_3665 OC=Bradyrhizobiaceae; Rhodopseudomonas.
Sequence
MTSVYDFSAKTLAGQQLPLQQFEGKVLLIVNTASACGFTPQYKGLEELQQAYGGRGFAVL
GFPCNQFGHQEPGDAAAIGQFCQKNYGVSFPMFDKVEVNGSDAHPLFRYLKAEKSGLLGA
AIKWNFTKFLVDRTGRVVARHAPTTTPQSLTKEIEALL
Download sequence
Identical sequences Q210I6
2005448186 2005450607 WP_011474082.1.69038 gi|90425149|ref|YP_533519.1| 316056.RPC_3665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]