SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q219M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q219M8
Domain Number 1 Region: 74-197
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000135
Family Glutathione S-transferase (GST), C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000435
Family Glutathione S-transferase (GST), N-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q219M8
Sequence length 204
Comment (tr|Q219M8|Q219M8_RHOPB) Glutathione S-transferase-like {ECO:0000313|EMBL:ABD86908.1} KW=Complete proteome; Reference proteome OX=316056 OS=Rhodopseudomonas palustris (strain BisB18). GN=RPC_1346 OC=Bradyrhizobiaceae; Rhodopseudomonas.
Sequence
MKLVFSPTSPFARKVRIVAIELGLIDGIAFVPAKVVPGEPNDDYVHTVNPLKKLPALILE
TGEVLVDSYVIAEYLDELAGGKLVPASGPERWRVKSDHSLIQGMLDSMLLCRYEKFVRPQ
PLQWQAWYDDQWTRVWNGLARFEQHDETLSAPLDLAQIALVCVLGYADLRFADCNWRQAF
PKLDAFHERMLTRPSVQISQPPKA
Download sequence
Identical sequences Q219M8
316056.RPC_1346 WP_011471813.1.69038 gi|90422857|ref|YP_531227.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]