SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q21EA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q21EA9
Domain Number 1 Region: 61-225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-23
Family Beta-D-xylosidase C-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q21EA9
Sequence length 235
Comment (tr|Q21EA9|Q21EA9_SACD2) Uncharacterized protein {ECO:0000313|EMBL:ABD82970.1} KW=Complete proteome; Reference proteome OX=203122 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024). GN=Sde_3715 OC=Cellvibrionaceae; Saccharophagus.
Sequence
MPRFTRKITANKYYTSKFIFLACALLSIFSALCHAEKTTFTLPGITEPVMATHNTSPPSI
NNNSFTLTANKGTDLYTTSSGEKKADNVPRLLFEAKSDFILSAKVTSQFGADYDGGGLLV
YAGENQWAKLLIEQVPNKTLLVSSSVTNTKGDGAYHAVINQPYIYLKIVRLTNRYFFYSS
LNGKDWQILRDFALGENKNAKIGFYNQAPIGEKIETLFSEISFRETTIKSYWQGE
Download sequence
Identical sequences Q21EA9
gi|90023355|ref|YP_529182.1| 203122.Sde_3715 WP_011470185.1.82451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]