SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q21ED8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q21ED8
Domain Number 1 Region: 10-155
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.58e-25
Family SMI1/KNR4-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q21ED8
Sequence length 157
Comment (tr|Q21ED8|Q21ED8_SACD2) Uncharacterized protein {ECO:0000313|EMBL:ABD82941.1} KW=Complete proteome; Reference proteome OX=203122 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024). GN=Sde_3686 OC=Cellvibrionaceae; Saccharophagus.
Sequence
MELEITPIAGAISESAIRDFEENIGMPFPPDYREFMLKYNGGDPLKCVFKFQNATGPYSD
SIIRYFFAFSDDYDESIKHNHEAYTLADRVPKNILPIAEDPGGNIVCLSLAGDDVGKVYF
WDHEQEGLTEASATYENLELIANSFTEFVDGLEEESY
Download sequence
Identical sequences Q21ED8
203122.Sde_3686 WP_011470156.1.82451 gi|90023326|ref|YP_529153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]