SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q21G32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q21G32
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000379
Family SMI1/KNR4-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q21G32
Sequence length 130
Comment (tr|Q21G32|Q21G32_SACD2) Uncharacterized protein {ECO:0000313|EMBL:ABD82347.1} KW=Complete proteome; Reference proteome OX=203122 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024). GN=Sde_3090 OC=Cellvibrionaceae; Saccharophagus.
Sequence
MREFLETVENLNSQYASIEIDGELDSLSHNFWSAAEIENGKNVQADWDVPAHLIPFYGDW
HDLFCLDSDSGKIVSLNDEREIIYVWSCIKDFIASLSTTEVELTKKPEIVSFSLSPDLLE
KANEFKKKNT
Download sequence
Identical sequences Q21G32
203122.Sde_3090 gi|90022732|ref|YP_528559.1| WP_011469563.1.82451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]