SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q22297 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q22297
Domain Number 1 Region: 82-322
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.7e-45
Family Nuclear receptor ligand-binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 7-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-21
Family Nuclear receptor 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q22297
Sequence length 334
Comment (tr|Q22297|Q22297_CAEEL) Nuclear Hormone Receptor family {ECO:0000313|EMBL:CAA90298.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_T07C5.5 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MDCITRSCKVCNEKTTGFNYGVQSCNACKMFFRRALDTPKVLKCGRDGNCPTIVLDSGES
QCRFCRFHKCIIVGMIFLDAVDDPTNIINKLLVMDTKRRDIFLNCTIPESLTVDEVFSRR
SFPFEPRKPGTVFNFCDWGVINHLSCISFIRQLDFIKFLSSQDTIAIFKYSHLMYLILVT
AMRSYLCKEAAMNHPGKVDVFPEEAQYAAGYNKQLLNDIRCLLVGRLSEIKITHEEFILL
SVIILCNPGATNLSKSGRIILASNQERFSSILLHYCLITNSKCGPARFNEILSLCHVVSR
TLSDLDNLTCLYSLVHTVPAPPNLFNNILKFLLH
Download sequence
Identical sequences Q22297
T07C5.5 NP_510119.1.50509 6239.T07C5.5 T07C5.5 T07C5.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]