SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q22NU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q22NU2
Domain Number 1 Region: 21-130
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000509
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0027
Further Details:      
 
Domain Number 2 Region: 207-283
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000183
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0027
Further Details:      
 
Weak hits

Sequence:  Q22NU2
Domain Number - Region: 307-361
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0102
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q22NU2
Sequence length 449
Comment (tr|Q22NU2|Q22NU2_TETTS) WH1 domain protein {ECO:0000313|EMBL:EAR87069.1} KW=Complete proteome; Reference proteome OX=312017 OS=Tetrahymena thermophila (strain SB210). GN=TTHERM_00418590 OC=Tetrahymena.
Sequence
MSQIQQQNSRAVPEEVKKLLQQVIGNKQTIMSIAIARIFTARSEGEWIYSNLQGILCLVW
DREKDNTPFLRLFDIETFDLLFEAEMYIDFHLSYASVNPTFYMFEYMNAFIGLQFISDSE
ASQFSLKVMTQSLKDVKPEQNIQQQQQPKEKKKEEKEGLFGFRKGLKKIVSNLFQKDGKH
NQDAENIEISKPISFQKVTSLQFNIKTNQFDFSNLNDEWKQIFSRAGIQQSDLSNEELAP
IIFESVIRFQSHYENQIENKQKESQQQQQQPNQQSNNNTQSTKQQNQTINEASQSIPVAP
QINMNIPPPPPMNLNIPPPPPINIPSAPVLDFNSSIKNNNIPAAPVIPNINDDKNRISIS
TQNKNFDSSQVMNKSSLLDQIKTGNFQLKHVEVNKKDNKANLDISQMDDQAQENLTLYLS
KCIAERRKQIRKHKYSSSEESNDSDDDDD
Download sequence
Identical sequences Q22NU2
XP_001007314.1.55412 3833.m00813 5911.XP_001007314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]