SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q24207 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q24207
Domain Number 1 Region: 9-116
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.33e-23
Family Canonical RBD 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q24207
Sequence length 228
Comment (sp|Q24207|BOULE_DROME) Protein boule KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=bol; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MHKIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVK
STKIIVDRAGVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKKQPNPLQSIV
ATNGAVYYTTTPPAPISNIPMDQFAAAVYPPAAGVPAIYPPSAMQYQPFYQYYSVPMNVP
TIWPQNYQENHSPLLHSPTSNPHSPHSQSHPQSPCWSIEDLRDTLPRV
Download sequence
Identical sequences A4V1Q0 Q24207
FBpp0076265 FBpp0076267 FBpp0076265 FBpp0076267 NP_001286992.1.81976 NP_523989.1.81976 NP_729456.1.81976 7227.FBpp0076267 FBpp0076265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]