SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q255L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q255L4
Domain Number 1 Region: 294-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-45
Family Ribonuclease PH domain 1-like 0.0000376
Further Details:      
 
Domain Number 2 Region: 12-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.57e-38
Family Ribonuclease PH domain 1-like 0.0000882
Further Details:      
 
Domain Number 3 Region: 449-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.31e-26
Family Ribonuclease PH domain 2-like 0.00015
Further Details:      
 
Domain Number 4 Region: 137-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.58e-26
Family Ribonuclease PH domain 2-like 0.0017
Further Details:      
 
Domain Number 5 Region: 553-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.09e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 6 Region: 619-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.44e-19
Family Cold shock DNA-binding domain-like 0.0005
Further Details:      
 
Domain Number 7 Region: 238-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000123
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q255L4
Sequence length 694
Comment (sp|Q255L4|PNP_CHLFF) Polynucleotide phosphorylase {ECO:0000255|HAMAP-Rule:MF_01595} KW=Complete proteome OX=264202 OS=Chlamydia felis (strain Fe/C-56) (Chlamydophila felis). GN=pnp OC=Chlamydia/Chlamydophila group; Chlamydia.
Sequence
MTFETISVTLEEGKTLVFETGKIARQANGAVLARMQETWVFSSVCAATLEEPVDFLPLRV
DYQEKFSSIGKTLGGFIKREGRPTEREILTSRLIDRSMRPSLPNRLMQDVQILSYVWSYD
GVTLPDPIAICGVSAALAISDIPQINIVAGVRVGFINNTWVVNPTKAEMDVSRMELVLAG
TEKAILMIEGHCDFFTEEQVIEAIEFGHKHIVTICKAIEDWQKQIGKEKNTSAVVPLPEQ
VQTAVNTLVEGKFSDLLQIKEKKAFEAASKQLENDIVEKLQEENEIFTPLNIKTAFKQAK
SDYMRSLIRKQGLRSDGRSVTTIRPISIDTSFLPRTHGSCLFTRGETQTVAVCTLGSEAM
AQRYEDLNGEGLAKFYLQYFFPPFSVGEVGRIGSPGRREIGHGKLAEKALSHALPDPAKF
PYTIRIESNITESNGSSSMASVCGGCLALMDAGVPIKTPIAGIAMGLILDDDHVTILSDI
SGLEDHLGDMDFKVAGNAEGITAFQMDIKVEGITPEIMQAALAQAKSGRQNILETMKATL
ASPKTDLSQYAPRIETMQIKPNKIATVIGPGGKQIRQIIEEAGVQIDINDSGLVSISASS
PQAIEKAKSIIEGLVGEVEVGKIYEGRVTSIVPFGAFVEILPGKEGLCHISEFSKQRIEN
VGDFVKQGDILPVKLLSINEKGQYKLSHKATLSE
Download sequence
Identical sequences Q255L4
WP_011457805.1.63481 gi|89898059|ref|YP_515169.1| 264202.CF0252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]