SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q25733 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q25733
Domain Number 1 Region: 47-266,295-479
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.49e-85
Family Duffy binding domain 0.00021
Further Details:      
 
Domain Number 2 Region: 853-920,950-982,1018-1116,1170-1350
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-72
Family Duffy binding domain 0.0008
Further Details:      
 
Domain Number 3 Region: 1728-2082
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-62
Family Duffy binding domain 0.0000719
Further Details:      
 
Domain Number 4 Region: 2085-2404
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.49e-55
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 5 Region: 507-670,715-735
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.93e-41
Family Duffy binding domain 0.007
Further Details:      
 
Domain Number 6 Region: 1347-1573
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-28
Family Duffy binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q25733
Sequence length 2924
Comment (tr|Q25733|Q25733_PLAFA) PfEMP1 variant 1 of strain MC {ECO:0000313|EMBL:AAB60251.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=MCvar-1 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGGGNGGGGTKDKDAKHALDRIGEEVYKEKVENDAEKYKKALKGNLQEAKGIGELASSPN
PCKLVEDYYNNRLKRKRYPCANRQTVRFSDEYGGQCTFNRIKDSENNDNSIGACAPYRRL
HLCDYNLEKMGKTSTTKHDLLLDVCMAAKYEGDSIKTHYTKHELTNPDTKSQLCTILARS
FADIGDIVRGKDLYLGYDDKEKDERKKLENNLIEIFKKIHENLGTQDAKDHYKKDEENYY
QLREDWWTANRSTVWKAITCHAGESDKYFRKTCCSGEWTDDKCRCKDEEGKNETNEVPTY
FDYVPQYLRWFEEWAEDFCRKRKKKIENAIKNCRGEKGNERYCDLNGYNCEETARGAEIF
VKGDDCHKCSVACDRFVKWIDNQRKEFDKQKKKYDEEINKTHGTTITTGNGKINNLYVGH
FYKILKKYYPTVDKSLQKLNDEAICKKPPNVGNEKASTVDFNNEVNTTFSHTTYCEACPW
CGAQKEKNGGGWKAKEKSCAKKKERIFNKENSTDIKILTPEKGRSKTLEKLKTFCKDGQK
IKNDIWKCHYDDNGTDDQTDDSNDCVLGDWGNLTKEDKIMSYNAFFWMWVHDMLIDSIKW
RDEHGRCINKDKGKTCIKGCNKKCICFQKWVEQKKTEWGKIKDHFRKQKDIPKDWTHDDF
LQTLLMKDLLLEIIQDTYGDANEIKRIEALLEQAGVGGIDFAALAGLYTKGFVAEKDTTI
DKLLQHEQKEADKCLKTHTDDTCPPQEDRSVARSESATVPSPPADPKATEEVDANASSDD
EDDFEEEEEEEEDEGEEEAEEVQEEKTDESATEAVAPSPPGTTQDGVKPASQEDDVKVCS
IVDKALKGKLDDACTLKYGKTAPTSWKCIPSGNNTTTESTTKPGAAGTPSGKDTGSICVP
PRRRKLYVGKLHDWAGGETTEAKSQETSGGQKTPSGNESSPSEKLPQGPTPETTKETPES
SLLHAFVSPPRLRRFLPWHKFKEQWKAQHGAGATGQQTIIGTLDGGGEETPDKLLKTGHI
PPDFLRQMFYTLGDYRDILVGNTDIVVHTSGNKEDMQIMEAIQKKIEQILPTSGSSPSPP
RVTQTQHSVENPRKTWWNENGKKIWEGMVCALTYNTDTPSGTAPTQIQEVRTKLRDENSK
NPKIPQYKYDQVKLDDTSDAKTTGSPVPSGEKITPLTDFISRPPYFRYLEEWGETFCKER
KKRLEKIKEECRGDRTGHEHCSGDGYDCTRTDADRNDKFVDLNCRDCHIQCRKYRKWIDI
KFDEYHKQEKKYQGEYDKLTKDKSSGGDNNCCKDIEKHKSAAVFLKELKHCKNGQTSENK
GNQEDQLNKLDFDKIPQTFSPSTYCKACPVYGVNCNGNKRGRGGTNGCTTNNEPENKEND
KGAASTISILINDGSTNGATNGTTGTTDETLKECSDKYAFFKGLRKQEWTCQKKYGVNQC
NLTNRVNDTYFDKDIVFNEFFQRWLRYFVHDYNILKHKIDPCIKKEKQDKTEHKCINGCN
IKCECVRKWLEIKGNEWGNIKKHYNINSNDDKETIAYNVKSYFVDQGLFDTDYKKAQKVV
EDEKERKKIWGCTGHDECSEKEKEENKNFITNLISELQDKITSCQNKHNPNGKTACDPFP
SPTPEETDPLDDDTPDPLDDDQHTEQPKFCPPPPPPMTCVEKIAKELRVEAEGKINNELK
GNGKDFNGKCNNVKKKNGAVIGEESCKFEQTYENSVNNINNKCKDNQNERFKIGQKWNFK
YIGTIRKDLCIPPRREHMCLDDLSMLGRTTISDSSALLKKIQEAAKSERDDIIRKLLEQN
SCDEHRICDAMKYSFADLGDIIRGRDLWNKNSKQKGLQKRLEYAFINIYNKLQNDKNKYE
KDRPKYLQLRSDWWDANRKHIWNAMTCNAPDDAKFLKKNPNDTSGSSSSKGIMTTHSNCG
YDKEPPDYDYIPQPFRWMQEWSESFCKLLNEEMEQFEKTCGECKKNSITCEDDRNGTNCE
NCKNQCEKYKKLIHNWKLGFDKYKEIYNEIYNNKDSKINSNEYFKKFLEKLKDKCKELNS
SDKCIDEATHCTKYKFSNSENKNHNNYAFKNPPKEYEKACKCDAPDPLDNCPKDSATYEK
ACNTLLPTKLCESKTFNNDDDSWDTSFVQTSPRDNTGVLVPPRRRQICLKNITTKLRSIE
KIDDFKAELMTSAYNEGKLLCELYKKDRDVTLQAMKYSFYDYGDIVKGTDLISTAPLDKL
KTKLNVLLKGDGTNEIKEDRGKWWTENRTRVWHAMLCGYKAAGGKIEERDCSLPDDNTHQ
FLRWFREWSEHFCAKRQKLFNEVKRECASAQCIIEYGTIDPPVCEEACTQYRDYITRKIQ
EYRLLNYQYNTNFNEKKAEVTKAPEYFNDKCNDKCNCLSKYIDIEKKWKNMYDSFDDNDL
KNKCICRQIKPKRPPKKVKPEEEHTPSEQDTPPPLPPKPDDLPPPAEEPFNRDILEKTIP
FGIALALGSIAFLFLKKKTKSSVGNLFQILHIPKSDYDIPTKLSPNRYIPYTSGKYRGKR
YIYLEGDSGTDSGYTDHYSDITSSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSGNNT
TASGKNTPSDTQNDIQNDGIPSSKITDNEWNTLKDEFISNMLQNEPNTEPNMLGYNVDNN
THPTTSRHNVEEKPFIMSIHDRDLYSGEEYSYNVNMVNNDIPISARNGNYSGIDLINDSL
NSNKVDIYDELLKRKENELFGTNHTKKNTSTNSVAKNTNTDPIHNQLNLFHTWLDRHRDM
CEKWDTNNKKEELLDKLKEEWNKDNNSGNINPSGNTPPTSDIPSGKQSDIPSDNNIHSDI
PYVLNTDVSIQIHMDNPKPINEFSNMDTYPNNSSMDTILEDLDKPFNEPYYYDVQDDIYY
DVHDHDTSTVDTNAMDEPSKVQIEMDVNTKLVKEKYPIADLWDI
Download sequence
Identical sequences Q25733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]