SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q25989 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q25989
Domain Number 1 Region: 415-765
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-74
Family Duffy binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 36-267
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.06e-45
Family Duffy binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q25989
Sequence length 921
Comment (tr|Q25989|Q25989_PLAFA) Plasmodium falciparum (clone pS31H) ORF {ECO:0000313|EMBL:AAC37240.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN= OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
KLNSVYTSIGLFLNSLKSGPCKKDNDNAEDNIDFGDEGKTFKEADNCKPCSQFTVDCKNC
NGGDTKGKCNGSNGKKNGNDYITASDIENGGNSIGNIDMVVSDKDANGFNGLDACGSANI
FKGIRKEQWKCAKVCGLDVCGLKNGNGSIDKDQKQIIIIRALLKRWVEYFLEDYNKINAK
ISHCTKKDNESTCTNDCPNKCTCVEEWINQKRTEWKNIKKHYKTQNENGDNNMKSLVTDI
LGALQPQSDVNKAIKPCSGLTAFESFCGLNGADNSEKKEGEDYDLVLCMLKNLEKQIQEC
KKKHGETSVENGGKSCTPLDNTTLEEEPIEEENQVEAPNICPKQTVEDKKKEEEEETCTP
ASPVPEKPVPHVARWRTFTPPEVFKIWRGRRNKTTCEIVAEMLKDKNGRTTVGECYRKET
YSEWTCDESKIKMGQHGACIPPRRQKLCLHYLEKIMTNTNELKYAFIKCAAAETFLLWQN
YKKDKNGNAEDLDEKLKGGIIPEDFKRQMFYTFADYRDICLGTDISSKKDTSKGVGKVKC
NIDDVFYKISNSIRYRKSWWETNGPVIWEGMLCALSYDTSLNNVNPETHKKLTEGNNNFE
KVIFGSDSSTTLSKFSERPQFLRWLTEWGENFCKEQKKEYKVLLAKCKDCDVDGDGKCNG
KCVACKDQCKQYHSWIGIWIDNYKKQKGRYTEVKKIPLYKEDKDVKNSDDARDYLKTQLQ
NMKCVNGTTDENCEYKCMHKTSSTNSDMPESLDEKPEKVKDKCNCVPNECNALSVSGSGF
PDGQAFGGGVLEGTCKGLGEPKKKIEPPQYDPTNDILKSTIPVTIVLALGSIAFLFMKVI
YIYVWYIYMLCVGALDTYICGCICICIFICVSVYVCVYVYVFLYMCVFYIYFIYIYVFIL
KMKKMKKMKKMKKMKKRKKRI
Download sequence
Identical sequences Q25989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]