SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q26126 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q26126
Domain Number 1 Region: 2-264
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.92e-57
Family Duffy binding domain 0.00000000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q26126
Sequence length 757
Comment (tr|Q26126|Q26126_PLAVI) Microneme protein-1 {ECO:0000313|EMBL:AAA61634.1} OX=5855 OS=Plasmodium vivax (malaria parasite P. vivax). GN= OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
YQLCMKELTNLVNNTDTNFHSDITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKD
IRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSFGTGEKAQQHRKQWWNESKAQIWTRMMY
SVKKRLKGNFIWICKINVAVNIEPQIYRWIREWGRDYVKELPTEVQKLKEKCDGKINYTD
KKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKVQTAGIVTPYDILKQELD
EFNEVAFENEINKRDGAYIELCVCSVEEAKKNTQEVVTNVDNAAKSQATNSNPISQPVDS
SKAEKVPGDSTHGNVNSGQDSSTTGKAVTGDGQNGNQTPAESDVQRSDIAESVSAKNVDP
QKSVSERSDDTASVTGIAEAGKENLGASNSRPSESTVEANSPGDDTVNSASIPVVSGENP
LVTPYNGLGHSKDNSDSDGPAEFAESTKSAESMANPDSNSKGETGKGQDNGMAKATKDSS
NSSDGTSSATGDTTDAVDREINKGVPEDRDKTVGSKDGGGEDNSANKDAATVVGEDRIRE
NSAGGSTNDRSKNDTEKNGASTPDSKQSEDATALSKTESLESTESGDRTTNDTTNSLENK
NGGKEKDLQKHDFKSNDTPNEEPNSDQTTDVEGHDRDSIKNDKAERRKHMNKDTFTKNTN
SHHLNSNNNLSNGKLDIKEYKYRDVKATRKNIILMSSVRKCNNNISLEYCNSVEDKISSN
TCSREKSKNLCCSISDFCLNYFDVYSYEYHSCMKKEF
Download sequence
Identical sequences Q26126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]