SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q26128 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q26128
Domain Number 1 Region: 2-264
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-58
Family Duffy binding domain 0.00000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q26128
Sequence length 759
Comment (tr|Q26128|Q26128_PLAVI) Microneme protein-1 {ECO:0000313|EMBL:AAA61636.1} OX=5855 OS=Plasmodium vivax (malaria parasite P. vivax). GN= OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
YQLCMKELTNLVNNTDTNFHSDITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKD
IRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSFGTGERAQQHAKQWWNESKAQIWTAMMY
SVKKRLKGNFIWICKINVAVNIEPQIYRWIREWGRDYVKELPTEVQKLKEKCDGKINYTD
KKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKVQTAGIVTPYDILKQELD
EFNEVAFENEINKRDGAYIELCVCSVEEAKKNTQEVVTNGDNAAKSQATNSNPISQPVDS
SKAEKVPGDSTRGSVNSGQDSSTTGKAVTGDGQNGNQTPAESDVQRSDIAESVSAKNVDP
QKSVSERSDDTASVTGIAEAGKENLGASNSRPSESTVEANSPGDDTVNSASIPVVSGENP
LVTPYNGLGHSKDNSDSDGPAEFAESTKSAESMANPDSNSKGETGKGQDNDMAKATKDSS
NSSDGTSSATGDTTDAVDREINKGVPEDRDKTVGSKDGGGEDNSANKDAATVVGEDRIRE
NSAGGSTNDRSKNDTEKNGASTPDSKQSEDATALSKTESLESTESGDRTTNDTTNSLENK
NGGKEKDLQKHDFKSNDTPNEEPNSDQTTDVEGHDRDSIKNDKAERRKHMNKDTFTKNTN
SHHSNSNNNLSNGKLDIKEYKYRDVKATRKNIILMSSVRKCNNNISLEYCNSVEDKISSN
TCSREKSKNLCCSISDFCLNYLDVYSYEYHSCMKKEFEE
Download sequence
Identical sequences Q26128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]