SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q27591 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q27591
Domain Number 1 Region: 130-373
Classification Level Classification E-value
Superfamily vWA-like 5.19e-70
Family Integrin A (or I) domain 0.00000125
Further Details:      
 
Domain Number 2 Region: 32-80
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000262
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 589-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000145
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number 4 Region: 527-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Integrin beta EGF-like domains 0.025
Further Details:      
 
Domain Number 5 Region: 386-462
Classification Level Classification E-value
Superfamily Integrin domains 0.0000575
Family Integrin domains 0.011
Further Details:      
 
Weak hits

Sequence:  Q27591
Domain Number - Region: 473-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Domain Number - Region: 618-675
Classification Level Classification E-value
Superfamily Translation initiation factor 2 beta, aIF2beta, N-terminal domain 0.017
Family Translation initiation factor 2 beta, aIF2beta, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q27591
Sequence length 799
Comment (sp|Q27591|ITBN_DROME) Integrin beta-nu KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG1762 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MTSLGGRAFLWIYLVFLIAEISHSDADSIDDQCRHADSCERCLSAHLECAWCTDKEYQVG
YRCLSRRQLLNYNCSETDIYENQPVLDVLQDKPLKDYETSDQAVQVTPQRAYLKLVKGNT
QRMKLSYRTARNNPLDLYVLMDLTWTMRDDKKTLEELGAQLSQTLKNLTGNYRLGFGSFA
DKPTLPMILPQHRENPCAAERATCEPTYGYRHQLSLTDDIPAFTSAVANSKITGNLDNLE
GGLDALMQVIVCTKEIGWKEQARKVVILVTDGFMHLAGDGLLAGIIQRNDKQCHLNKAGE
YTGSLNYDYPSLEEIYRELLRRKINVIFAVTEEVVSSYWELSALMKEISYVDILSADSSN
ILELIKKSYESLIKRTQFADNSPDFIDMAYYTDCGGQFPSLQKRNYCNNVTLGKQIDFYV
DVTLKKYPDNQVYTHKIRVEETSLSEFMDLDVELQRPCPCQETPDPENEEGRFLCDYKGY
LYCGMCECDEGWTGTYCNCPTDATNVTSNEALLQKCRQPFSDKSTSELVCSNHGDCDCGT
CLCDPGYTGPFCECRECLDCDEKLADCFCGQCVCKYGWSGSKCNCDGDTDACVGPTGEIC
SERGTCQCEECQCEEPYLGKFCEIDPEKDNKLCLFYEPCVTCLIEQKQGMGVCENLTEIC
SSLDRQETYPYNFVHELDPEQDQCLVRLVNKHGIQCDSFFVYQVIDHSNFLTIQAVDCEP
PDYVALVGYISAFTLLIGLLIIFIILWYIRAKDAREYAKFEEDQKNSVRQENPIYRDPVG
RYEVPKALSVKYDENPFAS
Download sequence
Identical sequences A0A0S0WGT1 Q27591
FBpp0080990 FBpp0080990 NP_001303333.1.81976 NP_523608.2.81976 7227.FBpp0080990 FBpp0080990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]