SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q27957 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q27957
Domain Number 1 Region: 47-178
Classification Level Classification E-value
Superfamily EF-hand 6.68e-47
Family p25-alpha 0.00000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q27957
Sequence length 218
Comment (sp|Q27957|TPPP_BOVIN) p25-alpha KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TPPP; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MADSRPKPANKTPPKSPGEPAKDKAAKRLSLEAEGAGEGAAAAGAELSALEEAFRKFAVH
GDARASGREMHGKNWSKLCRDCQVIDGRSVTVTDVDIVFSKIKGKSCRTITFEQFKEALE
ELAKKRFKDKSAEEAVREVHKLIEGKAPIISGVTKAISSPTVSRLTDTSKFTGSHKERFD
PSGRGKGRAGRVDLVDESGYVPGYKHAGTYDQKVQGGK
Download sequence
Identical sequences Q27957
9913.ENSBTAP00000007046 NP_776401.1.59421 NP_776401.1.76553 ENSBTAP00000054983 ENSBTAP00000054983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]