SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q28BU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q28BU9
Domain Number 1 Region: 59-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000785
Family EGF-type module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q28BU9
Sequence length 156
Comment (tr|Q28BU9|Q28BU9_XENTR) Epiregulin {ECO:0000313|EMBL:CAJ83368.1, ECO:0000313|Ensembl:ENSXETP00000013959} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=TNeu108c05.1-001 OC=Silurana.
Sequence
MECFRNLYSLLVLVGVHLMYAVNGTTVVPLCQPSESSENCTTAMVQTTHSPKPVPMKIGK
CQMEMESFCWNGQCMYLVDLDEHYCRCEKGYTGIRCSHAELIYQPMNQEYLAITLFLSSL
LLLAVVVAAFFAYKWYKTKKAELPHNEYKEVSIQNL
Download sequence
Identical sequences Q28BU9
ENSXETP00000013959 gi|113931422|ref|NP_001039160| gi|89272484|gb|CAJ83368| 8364.ENSXETP00000013959 ENSXETP00000013959 NP_001039160.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]