SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q28E31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q28E31
Domain Number 1 Region: 531-777
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-61
Family Nuclear receptor ligand-binding domain 0.00000000307
Further Details:      
 
Domain Number 2 Region: 419-501
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.71e-27
Family Nuclear receptor 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q28E31
Sequence length 778
Comment (tr|Q28E31|Q28E31_XENTR) OTTXETP00000005984 {ECO:0000313|EMBL:CAJ81814.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=TEgg138n17.1-001 OC=Silurana.
Sequence
MDPKDLLKPSSGSPAVKGSPHYNDKPGNVLEFFGNYRGGVSVSVSASCPTSTASQSNTRQ
QQQFLKQKAVTGDSTNGLNNVPQPDLSKAVSLSMGLYMGEPDTKGMGNDIAFPPQEQTGI
STGETDFSLLEESIASLQATTLPPDRLLEMPEDPGVLKCDVSAQPRPSMLGQGGSNGNST
IKLSLTDQSTFDLLQDLDIPPDSPTGGKRNPWLDPLFDEEEAFSLLTPLATDDTFLMKSE
VLSESSKPLGLEDSTHKLSDRAKEGLLSTAALPVTQVKTEKEDYIELCTPGVVKQEKFGP
VYCLGGLSGSGLFGNKSSAISVHGVSTSGGQMYHYDLNTSTISQHQQDLKPIFNLGSPGT
SIAEGWNRCHGSVDDSSASPGNVNFPNRSVFSNGYSSPGIRPDVSPSPSTSSTSTGPPPK
LCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYR
KCLQAGMNLEARKTKKKIKGIQQSNTVATREPPESSVTRTMVPAAVAQLTPTLISLLEVI
EPEVLYSGYDSSIPDTTRRLMSSLNMLGGRQVVSAVRWAKAIPGFRNLHLDDQMTLLQYS
WMFLMVFALGWRSYKQANGSVLYFAPDLVITDDRMHLPFMQERCQEMLKIAGEMSRLQIS
YDEYLCMKVLLLMCTIPKEGLKSHALFEEIRMTYIKELGKAIVKREGNSSQNWQRFYQLT
KLLDSMHEVAENLLAFCFLSFLDKSMSIEFPDMLSEIISNQIPKYSSGNIKKLLFHQK
Download sequence
Identical sequences Q28E31
NP_001016967.1.99540 gi|62858859|ref|NP_001016967| gi|89271883|gb|CAJ81814| 8364.ENSXETP00000003968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]